Official repository for IgFold: Fast, accurate antibody structure prediction from deep learning on massive set of natural antibodies.
The code and pre-trained models from this work are made available for non-commercial use (including at commercial entities) under the terms of the JHU Academic Software License Agreement. For commercial inquiries, please obtain a license through Johns Hopkins Technology Ventures.
Try antibody structure prediction in Google Colab.
- Version 1.0.1
- Pre-trained weights are stored in the repository and included in the wheel (1.0.0 wheels shipped without them)
- Version 1.0.0
- Requires PyTorch >= 2.0 and transformers >= 4.36 (5.x supported); PyTorch-Lightning is no longer a dependency
- Model weights in safetensors format (`igfold convert-weights` converts .ckpt files); AntiBERTy weights
are downloaded from the Hugging Face Hub on first use
- `igfold` command-line interface; batched prediction and pooled sequence embeddings in the Python API
- Device selection (`--device cuda:1`; "mps" supported); `IGFOLD_WEIGHTS_DIR` for external weights
- Locked pixi environments; renumbering uses ANARCII (pip-installable, no HMMER)
- mmCIF output (`.cif` extension); residue numbering restarts for each chain
- Input validation (chain ids, residue alphabet, sequence length)
- Templates are aligned to the input sequences, allowing mutations and missing residues
- OpenMM >= 8 supported for refinement
- Fixes to the gradient refinement (chain-boundary masks in the violation losses, coordinates now
correspond to the final refined frames) and to backbone O placement at chain ends
IgFold is managed with pixi, which installs Python, PyTorch and the optional refinement and renumbering dependencies (OpenMM, pdbfixer, ANARCII) into a locked environment inside the repository. Install pixi, then:
git clone git@github.com:Graylab/IgFold.git
cd IgFold
pixi install -e fullThree environments are defined in pyproject.toml:
| Environment | Command | Contents |
|---|---|---|
default |
pixi install |
Structure prediction only (PyTorch, AntiBERTy, Biopython) |
full |
pixi install -e full |
Adds OpenMM + pdbfixer refinement, ANARCII renumbering, and plotting |
dev |
pixi install -e dev |
full plus pytest, ruff and pre-commit |
Run anything inside an environment with pixi run -e <env> <command>, or open a shell with
pixi shell -e full. The -e full flag is omitted in the examples below when the default
environment is enough.
The four pre-trained model weights (igfold/trained_models/IgFold/igfold_*.safetensors, 25 MB in
total) are stored in this repository and included in the PyPI package. To use weights from another
location, point the IGFOLD_WEIGHTS_DIR environment variable (or --weights-dir) at a directory
containing them. Legacy .ckpt weights from IgFold <= 0.4.0 are converted automatically on first
use (or explicitly with igfold convert-weights).
The AntiBERTy language-model weights (about 100 MB) are downloaded from
huggingface.co/jeffruffolo/AntiBERTy on first use
and cached in ~/.cache/huggingface; set ANTIBERTY_WEIGHTS_DIR to use a local copy offline.
IgFold (with the pre-trained weights) is also on PyPI, for Python >= 3.11 and PyTorch >= 2.0:
pip install igfold # prediction only
pip install "igfold[refine,renum,viz]" # with OpenMM refinement, ANARCII renumbering and plottingChothia renumbering (--renumber) and trimming of full-length chains to the variable domain
(--truncate) use ANARCII, a pip-installable numbering tool
(pixi install -e full, or pip install "igfold[renum]"). Its weights ship with the package, so no
external binaries or databases are needed.
The manuscript refined structures with PyRosetta, which is
distributed under its own license and is not installed by pixi. If PyRosetta is importable in the
environment, --refine pyrosetta uses it; otherwise use --refine openmm.
Predict a paired Fv, refine it with OpenMM, and renumber it (Chothia):
pixi run -e full igfold fold \
-H EVQLVQSGPEVKKPGTSVKVSCKASGFTFMSSAVQWVRQARGQRLEWIGWIVIGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAAPYCSSISCNDGFDIWGQGTMVTVS \
-L DVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK \
-o my_antibody.pdb --refine openmm --renumberA nanobody (or a single heavy or light chain) is predicted by giving one sequence:
pixi run igfold fold \
-H QVQLQESGGGLVQAGGSLTLSCAVSGLTFSNYAMGWFRQAPGKEREFVAAITWDGGNTYYTDSVKGRFTISRDNAKNTVFLQMNSLKPEDTAVYYCAAKLLGSSRYELALAGYDYWGQGTQVTVS \
-o my_nanobody.cifpixi run fold ... is a shortcut for pixi run igfold fold ....
Predicts one structure from sequences given on the command line or in a FASTA file. Run
igfold fold --help for the full option list.
Input. Give exactly one of the following. Sequences must be antibody variable domains (Fv, roughly 110-130 residues per chain) made of the 20 standard amino acids; lowercase and whitespace are accepted.
| Option | Description |
|---|---|
-H, --heavy SEQ |
Heavy chain (or nanobody) sequence, written as chain H. Combine with -L for a paired Fv. |
-L, --light SEQ |
Light chain sequence, written as chain L. |
--chain ID SEQ |
Any chain id (one character) and sequence; repeat for several chains. |
--fasta FILE |
FASTA file with one record per chain. Record ids (or the part after a :) become chain ids. |
--truncate |
Trim each sequence to its variable domain (ANARCII numbering) before prediction. Use this if you have full-length chains. |
Output.
| Option | Description |
|---|---|
-o, --output FILE |
Required. .pdb writes PDB; .cif or .mmcif writes mmCIF. Per-residue predicted RMSD (Å) is stored in the B-factor column. Residue numbering starts at 1 for each chain unless --renumber is given. |
--renumber |
Renumber residues with the Chothia scheme (ANARCII). |
-q, --quiet |
Suppress progress messages. |
Refinement. IgFold predicts backbone and CB atoms; refinement builds and relaxes the full-atom structure while restraining the predicted backbone.
| Option | Description |
|---|---|
--refine none |
Default. Backbone-only output (N, CA, C, O, CB). Takes a few seconds on CPU. |
--refine openmm |
Full-atom refinement with OpenMM and pdbfixer (full environment). |
--refine pyrosetta |
Full-atom refinement with PyRosetta, as in the manuscript (must be installed separately). |
Templates. A template structure guides the prediction, for example a parent antibody when
predicting a point mutant. Template chains are matched to the input by chain id (H/L, or the
legacy A/B) and then aligned to the sequences, so missing residues and mutations are tolerated.
| Option | Description |
|---|---|
--template PDB |
Template structure. |
--ignore-cdrs [CDR ...] |
Predict these CDRs without the template: any of h1 h2 h3 l1 l2 l3 (Chothia definitions, requires a Chothia-numbered template with chains H/L). With no value, all six CDRs are ignored. |
--ignore-chain ID |
Predict this whole chain without the template. |
Model and hardware.
| Option | Description |
|---|---|
--num-models N |
Number of ensemble models to run, 1 to 4 (default 4). The prediction with the lowest predicted RMSD is kept. |
--device DEV |
cpu, cuda, cuda:1, mps, ... Default: the first CUDA device if available, otherwise CPU. |
--weights-dir DIR |
Directory containing igfold_*.safetensors (default: packaged weights or IGFOLD_WEIGHTS_DIR). |
Examples:
# FASTA input, mmCIF output, single model on a specific GPU
pixi run igfold fold --fasta my_antibody.fasta -o my_antibody.cif --num-models 1 --device cuda:1
# Full-length chains: trim to the Fv, refine and renumber
pixi run -e full igfold fold --fasta full_chains.fasta -o fv.pdb --truncate --refine openmm --renumber
# Predict a mutant using the parent structure as a template, except for CDR H3
pixi run igfold fold -H <mutant heavy> -L <light> --template parent.pdb --ignore-cdrs h3 -o mutant.pdbConverts legacy IgFold <= 0.4.0 .ckpt weight files to safetensors, writing a .safetensors file
next to each input. Without arguments it converts every .ckpt in the weights directory.
pixi run igfold convert-weights # all .ckpt files in the weights directory
pixi run igfold convert-weights path/to/igfold_1.ckptThe same functionality is available from Python, including batched prediction of many antibodies, per-residue and pooled sequence embeddings, and access to the raw coordinates and predicted RMSD:
from igfold import IgFoldRunner
igfold = IgFoldRunner()
out = igfold.fold("my_antibody.pdb", sequences={"H": heavy, "L": light}, do_refine=False, do_renum=True)
out.coords # (1, L, 5, 3) N, CA, C, CB, O
out.prmsd # (1, L, 4) predicted RMSD for N, CA, C, CBSee docs/python_api.md for the full reference.
pixi install -e dev
pixi run -e dev test # pytest (tests needing weights are skipped if none are installed)
pixi run -e dev lint # pre-commit: ruff lint + format, whitespace and file checks
pixi run -e dev pre-commit installPredictions are checked against reference structures in tests/data/; CI runs the test suite on
Linux and macOS.
To demonstrate the capabilities of IgFold for large-scale prediction of antibody structures, we applied the model to two sets of natural paired antibody sequences.
The first set contains 104K non-redundant paired antibody sequences from the Observed Antibody Space database. These predicted structures are made available for use online.
wget https://data.graylab.jhu.edu/OAS_paired.tar.gzThe second set contains 1.3M unique paired antibodies from four human donors, collected by Jaffe et al.. These predicted structures are made available for use online.
wget https://data.graylab.jhu.edu/Jaffe2022.tar.gzIf you run into any problems while using IgFold, please create a Github issue with a description of the problem and the steps to reproduce it.
@article{ruffolo2023fast,
title={Fast, accurate antibody structure prediction from deep learning on massive set of natural antibodies},
author={Ruffolo, Jeffrey A and Chu, Lee-Shin and Mahajan, Sai Pooja and Gray, Jeffrey J},
journal={Nature communications},
volume={14},
number={1},
pages={2389},
year={2023},
publisher={Nature Publishing Group UK London}
}
@article{ruffolo2021deciphering,
title = {Deciphering antibody affinity maturation with language models and weakly supervised learning},
author = {Ruffolo, Jeffrey A and Gray, Jeffrey J and Sulam, Jeremias},
journal = {arXiv},
year= {2021}
}